SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009108 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009108
Domain Number 1 Region: 939-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 756-905
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 594-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000401
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 4 Region: 892-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000519
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009108
Domain Number - Region: 1059-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 674-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000765
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 127-171
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family VWC domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009108   Gene: ENSDORG00000009692   Transcript: ENSDORT00000009691
Sequence length 1220
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4630:64786:99589:1 gene:ENSDORG00000009692 transcript:ENSDORT00000009691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRGEHAGAWLALALALSVRPGAAVPWRDCTGVECPQLENCIEEALEPGACCASCVRQGC
ACEGYQYYDCVRGGFVDGRVPAGRSYFVDFGSTECSCPPGGGRISCQFMLCPELPPNCIE
AVVMADSCPQCGQLGCVHGGRKYAAGHTAHLSPCRACHCPDAGGELICYRLPGCHGNISD
TEEADPERHYEEDPYSYDQEAAEAELGAALAGEAQAGAPPAALGAGAQPLASFRAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSIKDLIETCCAAGQQWAIDKDECLEIPESGPEGDTCRTAQKHCCISYLKEKSCV
AGVMGAKEXXXXXXXXXXXXXXXXXXQCCDCCGLGLRVRAEGQSCESNPNLGYPCNHVML
SCCEGEDPLMVPEVRQPPEPQAAPRRVSEAEVVSREALTLGTEAELPNSLPGDDQDECLL
LPGELCQHLCINTVGSYRCACFPGFSLQDDGRSCRPDGEPRQLDVAPEPAPRPEPAPAAS
NSIPMPVPQPNCKDNGPCRQVCRIIGGAAMCSCFPGYAIMADGVSCEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINECVTDLHTCSRGQHCLNTVGSFR
CYQELTCEPGYEFKEGECLDVDECAVGTHNCQAGFSCQNTEGSFYCQARQRCMDGFLLDP
EGNCVDINECTSLSAPCRPGFSCINTVGSYTCQRSPLACRRGYHASEDGSQCVDVNECET
GVHRCGEGQLCHNLPGSYRCDCKAGFQRDAFGRACVDVNECWASPGRLCQHTCENTPGSY
RCSCAAGFVLAADGKRCEDVNECESQRCSQECANIYGSYQCYCRQGYQLAEDGHACTDID
ECAQGAGILCTFRCVNVPGSYQCACPEQGYTMLANGHSCKDLDECALGTHNCSADQTCHN
LQGSFRCLRFECPPNYARVSETKCERTACQDIAECQSSPARITYYQLSFQTGLPVPAHIF
RIGPAPAFVGDTISLTITKGNEGAYFGTRRLNAYTGVVFLQRPVLEPRDFALDVEMRLWR
QGSITTFLAKMHIFFTTLAP
Download sequence
Identical sequences ENSDORP00000009108 ENSDORP00000009108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]