SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009125 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009125
Domain Number 1 Region: 493-828
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.49e-113
Family PDEase 0.000000274
Further Details:      
 
Domain Number 2 Region: 53-248
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-33
Family GAF domain 0.00037
Further Details:      
 
Domain Number 3 Region: 234-278,305-454
Classification Level Classification E-value
Superfamily GAF domain-like 3.38e-31
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009125   Gene: ENSDORG00000009708   Transcript: ENSDORT00000009708
Sequence length 854
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2818:363:25981:1 gene:ENSDORG00000009708 transcript:ENSDORT00000009708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTEEQVRSFLDGNPSFAHEYFGKKLSPENVAEACEDGRLVDCDNLRELCQVEESVALF
ELVQDMQESINMERVVFKVLRRLCTILHADRCSLFMYRQRNGVAELATRLFSVQPGSLLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVPDVACPHFSPFADELTDYVTRNILAMPTM
NGKDVMAVIMAVNKLDGPCFTSEDEDIFTKYLNFATLNLKIYHLSYLHNCETRRGQVLLW
SANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDIWPVLMGEAQPYS
GPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALVSGLPTYVAESGFICNIMNAS
ADEMFAFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDDHDEVLMESL
TQFLGWSVLNTDTYDKMNKLENRKDIAQDMVLYHVRCDKDEIQEILPTRERLGKEPADCE
EEELGRILKEELPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVLV
RFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDH
RGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLMD
IAIIATDLALYFKKRTMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACDLSA
ITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFVCTF
VYKEFSRFHEEILPMFDRLQNNRKEWKALADEHEAKVKALEEKKKEEENVAAKKVGMEVC
NGGPAPKSSTCCIL
Download sequence
Identical sequences ENSDORP00000009125 ENSDORP00000009125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]