SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009137 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009137
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.71e-23
Family FAD-linked reductases, N-terminal domain 0.071
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009137
Domain Number - Region: 276-312,478-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00175
Family FAD-linked reductases, N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009137   Gene: ENSDORG00000009720   Transcript: ENSDORT00000009720
Sequence length 552
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_251:13820:27871:-1 gene:ENSDORG00000009720 transcript:ENSDORT00000009720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSASRVPEKLDVVVIGSGIGGLASAAFLAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDT
GIHYIGRMQEGSTGRFILDQITEGQLDWAALSSPFDIMILEGPNGRKEYPMYSGTKAYIR
GLKEKFPQEEAVIDKYMNLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVKKGHELVNIYCPVVISSAGLFN
TYKHLLPESARCLPGVKQQLGMVRPSMGMLSVFICLKGTKEDLGLQSTNYYVYFDTDMDK
AMENYISVPREKAPEHIPFFFIAFPSAKDPTWEDRFPGRSTMIFLMPAAFEWFEEWQQEP
QGKRGIDYETVKNSFVEASMSLAMKLFPQLEGKVESVTAGSPLTNQFFLAAPQGATYGAD
HDLSRLHPHVMASIRAQSPIPNLYLTGQDIFTNGLMGALQGALLCSSAILNRNLYSDLKA
LGARVQAQKKKM
Download sequence
Identical sequences ENSDORP00000009137 ENSDORP00000009137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]