SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009204 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009204
Domain Number 1 Region: 150-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.59e-48
Family Neurolysin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 512-651
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-32
Family Neurolysin-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009204   Gene: ENSDORG00000009787   Transcript: ENSDORT00000009788
Sequence length 653
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_186:375:74827:-1 gene:ENSDORG00000009787 transcript:ENSDORT00000009788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCTRRLSGLGAGVAAAWPCRAGRGSLGPGSPTRRVSTSWSPVGAAFNVRPQGRRLDLFG
ERRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNTNVDLYQSLQKLLADKTLMESLDAETR
RVAELFMFDFEISGIHLDEEKRRRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIQH
NFVSDGSHVVVDGLHAEAPDDLVREAAYKIFLYPSSSQLKCLEQLLISRNLLAKLVGYST
FSHRALQGTIAQTPETVMQFLEKLSDKLSEXXXXXFEMMRMKMKLPQSELMPWDPPYYSG
VIRAERYNIEPSLYCPFFSLGACMEGLNILFNKLLGISLYAEQPMKGEVWCEDVRKLAVV
HESEGLLGYIYCDFFQRADKPHQDCHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRCPTDFAEVPSILMEYFSNDYRVVNQF
ARHYQTGQPLPKHMVSRLCESKKVCAAAEMQLQVFYATLDQIYHGRHPLRKSTTDILKDT
QERFYGLPYVPHTAWQLRFSHLVGYGAKYYSYLMSRAVASMVWKECFLQDPFN
Download sequence
Identical sequences ENSDORP00000009204 ENSDORP00000009204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]