SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009235 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009235
Domain Number 1 Region: 190-351
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.67e-24
Family Dual specificity phosphatase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 47-174
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000361
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009235
Domain Number - Region: 378-401
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.018
Family PLC-like (P variant) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009235   Gene: ENSDORG00000009824   Transcript: ENSDORT00000009824
Sequence length 401
Comment pep:novel scaffold:dipOrd1:scaffold_17:609070:638869:-1 gene:ENSDORG00000009824 transcript:ENSDORT00000009824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSSDSTMESVEEDRSKVQNDDGDEYVAPHDSDPKKILRFVMTSLPFRILGILLFLTDLV
LTVVDILVPQSEHYIPFQYRATSLAISLFFLIEVLLQIYVDGKKHYFSDTFNILDTLIIG
VTFFIDITYMFLDLKIFKDMSRSINLVRPLQLITLLRLLHLVNQRRHLEEDIRRRLISGD
TERYSKDRLTLNLTYITERIISISFPASLQQSLYRNSIEEVIRFLDTKHSDHYLVCNLCS
EESFDPQHTHDRMRWIRIEDPFVPTLEMILLSKEVIDLLAMNAQNVIVIHCKGGKGRTET
MIYTCLIATGMFLTTKETIDPSGEQRYHTTYTNEFQKIAIPSQHRYVEYFKIVKNVFHGN
LPPKRKLKIERIVVDSLHNLPKYYQSCAFFLCFHTSLVKNN
Download sequence
Identical sequences ENSDORP00000009235 ENSDORP00000009235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]