SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009241 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009241
Domain Number 1 Region: 28-156
Classification Level Classification E-value
Superfamily C-type lectin-like 2e-35
Family Link domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009241   Gene: ENSDORG00000009830   Transcript: ENSDORT00000009830
Sequence length 319
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1681:41774:54181:-1 gene:ENSDORG00000009830 transcript:ENSDORT00000009830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKYICLLWLLTSIWTTGLVQGSISVQELTISVPCRIMGVTVVSKKADLLMNFTEAKEAC
KLLGLTLASKDQVAAAQKFGFETCSYGWVRERYTVIPRILPNPRCGKNGIGVLTWNAPVN
RKFKAYCYNSSDTWVNSCLPETITTFDPMFDSQTVTYTAELTMGDSTSSSISSTHSTRAL
ATTPAPVTTSIPRKTKLICITEVYTETSSAATETEPTIESEAAFKNEVAGFGGVPTALLV
LALLFFGAAAGLAVCYIKRYVKAFFTNKNXXXXXXXXXXXXXXKADDGNANEESKKTEKT
SEESKSPSKTTVRCLEAEV
Download sequence
Identical sequences ENSDORP00000009241 ENSDORP00000009241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]