SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009265 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009265
Domain Number 1 Region: 170-347
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.13e-18
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009265   Gene: ENSDORG00000009857   Transcript: ENSDORT00000009857
Sequence length 851
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5066:58683:89036:-1 gene:ENSDORG00000009857 transcript:ENSDORT00000009857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKWANLDSRESEDTPQENSYPDPPNGDPNCKSPPAKPHISTAKSHTRLSGKGESGEALL
MDCSYKEGKLNSCPTITVSSAATILRPGDGPACITQSSQDPVPTSVEKPLKLYDRRSIFD
AVAQSNCQELESLLPFLQKSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTISLLLDI
AQQTGSLDEFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFKKT
KGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTT
DNTKFVTSMYNEILILGAKLHPTLKLEELTNKKGLTPLTLAASSGKIGXXXXXXXXXXXV
LAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPYEMKNT
VGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSIKTLFVDSYSEMLFFVQSLFMLASVV
LYFCHHKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFL
FGFSTAVVTLIEDGKNDSVLAEPTLQSRRGPCKVQPPDNYNSLYFTCLELFKFTIGMGDL
EFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILD
TEKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDEVNWTTWNTNVGIINEDPGNCE
GVKRTLSFSLRSGRVSGRNWKNFALVPLLRDVNTRERHPAQPEEVHLKHFTGSLKPEDAE
VSKDSVAPGEK
Download sequence
Identical sequences ENSDORP00000009265 ENSDORP00000009265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]