SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009290 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009290
Domain Number 1 Region: 571-603,642-701
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009290   Gene: ENSDORG00000009885   Transcript: ENSDORT00000009884
Sequence length 740
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4196:14783:19205:1 gene:ENSDORG00000009885 transcript:ENSDORT00000009884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESEEQHDLSLRASDEEKDSFSSGVPLETQKETSTDFKQLETDNQCRSYRGIHLEPQE
KTNTSIKQFITKKLQKSCQCSPTKAKNMVYEFLPVLRWLPKYDLKRNILGDVMSGLIVGI
LLVPQSIAYSLLAGQEPIFGLYTSFFASIIYFLFGTSRHISVGIFGVLCLMIGEVVDREL
HKAGYPTAGIAPSFGVISNASTLINNMSHRICDKSCYAIKVGSTVTFLAGVYQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLITTWIHIFKNILKT
NLCDLITSILCLLVLLPTKEINEHFKSKLKAPIPTELIVVVAATLASHFGKLNENYNSSI
SGHIPTGFMPPKAPDWDLIPNVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYA
IGFCNIIPSFFHCITTSAALAKTLVKESTGCQTQLSAVVTALVLLLVLLVIAPLFFSLQK
CVLGVITIVNLRGALCKFRDLPKMWRVSKMDTVIWFVTMLCSALISTEIGLLIGVCFSMF
CVILRTQKPKISLLGFVEESEIFECMTDYKNLQTKPGIKVFRFIAPLYYINKESFKSALY
KKTLNPVLVKAAQKKAAKRKLKEETVTLSGIQDEVSVQLSHDAVELHTVVIDCSAIQFLD
TAGIQTLKEVRRDYEAIGIQVLLAQCNPSVRDSLVRGEYFKEDEENLLFYSVYKAVAFAV
ESQNQKGVCLLNGISTDGDK
Download sequence
Identical sequences ENSDORP00000009290 ENSDORP00000009290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]