SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009318 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009318
Domain Number 1 Region: 130-408
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.08e-78
Family Eukaryotic proteases 0.0000000841
Further Details:      
 
Domain Number 2 Region: 16-79
Classification Level Classification E-value
Superfamily GLA-domain 1.24e-24
Family GLA-domain 0.00019
Further Details:      
 
Domain Number 3 Region: 68-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000399
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009318   Gene: ENSDORG00000009914   Transcript: ENSDORT00000009914
Sequence length 421
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2483:78958:84427:1 gene:ENSDORG00000009914 transcript:ENSDORT00000009914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLAQEEAHSVLHRHKRANHFLEELRPGNLERECKEEQCSFEEALEIFKSPERTKQFWSLY
TDGDQCASNPCQHGGSCMDQLQSYICFCLPNFEGRNCETDKDSQLICANENGGCEQYCSD
HPGAKRSCGCHEGYALLPDGVSCAPTVDYPCGKVPILEKRIAVALQSRIVGSRVCPKGEC
PWQAALLVQGQLLCGGTLLTPSWLVSAAHCFDKIHSWRNMSVVLGEHDLSEVDGTEQVRW
VAQLIIPSKYIVGKTDHDIALLRLHRPVVLSDYVVPLCLPKRAFSEGTLASIRFSWVSGW
GQLLDRGATTLELMAVDVPRMLTQDCLEQSRQTPESPVLTENMFCAGYLDGSKDSCKGDS
GGPHATLYRGTWYLTGVVSWGEGCAAVGHVGVYTRVSRYTEWLTKHMSSRPRLGIMRAPL
D
Download sequence
Identical sequences ENSDORP00000009318 ENSDORP00000009318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]