SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009321 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009321
Domain Number 1 Region: 192-402
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.74e-29
Family Eukaryotic proteases 0.0011
Further Details:      
 
Domain Number 2 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 1.18e-21
Family GLA-domain 0.00055
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 4 Region: 126-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000286
Family EGF-type module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009321   Gene: ENSDORG00000009918   Transcript: ENSDORT00000009918
Sequence length 402
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2483:108707:119223:1 gene:ENSDORG00000009918 transcript:ENSDORT00000009918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRVLLLWGLLLLLVLPQVRLSVFLSAPRASAVLGRWRRAGSYLLEELLQGDLERECYE
EICVYEESREVFEDDVLTEEFWRQYRGGFPCTSQPCFNNGSCQDHIRAYTCTCSPGYEGK
NCEMATNECHPERTDACQHFCHPGQVSYMCSCARGHRLGPDHKACLPMXXXXXXXXXXXX
XXXXXXXXXXXVKLTNSKGRDFCGGVLIQEDFVLTTAKCSLQHRNISVKVGCDPSKEPQA
IRIKRAHVHLWYEEESGQNDVSLLELEQPVPCPALGRPICIPERDFAERVLIPGTQGLLS
GWILNGTDPGALPAGLPVTYVDGEECEQALNVTVTTRISCERGEVMPGQWLEGSTVTREH
RGTWFLTGILGSSPAPPPAGQAHRFLLTTIPRYSLWFTQTMK
Download sequence
Identical sequences ENSDORP00000009321 ENSDORP00000009321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]