SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009347 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009347
Domain Number 1 Region: 109-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.08e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 243-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000022
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 3 Region: 47-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000765
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009347
Domain Number - Region: 281-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009347   Gene: ENSDORG00000009947   Transcript: ENSDORT00000009946
Sequence length 443
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5407:30456:37824:-1 gene:ENSDORG00000009947 transcript:ENSDORT00000009946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFASCLRGSLLLWALLLLLLGAASPQESEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAEHPSSCPPGYXXXXXXX
XXXVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECEMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDTDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLMATRLCQDIDECESGGHQCSEAQTC
VNFHGGYRCVDTNRCVEPYIQVSDNRCLCPASNPLCREQPSSIVYRYMSITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences ENSDORP00000009347 ENSDORP00000009347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]