SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009362 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009362
Domain Number 1 Region: 8-167
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.79e-39
Family Dual specificity phosphatase-like 0.00000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009362   Gene: ENSDORG00000009960   Transcript: ENSDORT00000009961
Sequence length 174
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_31867:3698:9192:1 gene:ENSDORG00000009960 transcript:ENSDORT00000009961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNRPAPVEVTYKNMRFLITHNPTNAAXXXXXXXELKKYGVTTIVRVCEATYDTTLVE
KEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALAL
IEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDANGHRNNCCIQ
Download sequence
Identical sequences ENSDORP00000009362 ENSDORP00000009362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]