SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009369 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009369
Domain Number 1 Region: 419-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-22
Family MAM domain 0.00094
Further Details:      
 
Domain Number 2 Region: 44-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 3 Region: 137-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009369   Gene: ENSDORG00000009968   Transcript: ENSDORT00000009968
Sequence length 565
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3264:158100:218329:1 gene:ENSDORG00000009968 transcript:ENSDORT00000009968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLAALALLGSLYLPAAADFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGHCQPVC
QPQCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTFGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVLKGQVRCQCPSPGLQLAPDGRTCVDVDECATGKVSC
PRFRQCVNTFGSYICKCHKGFDLMYIGGKYQCHDVDECSLGQHQCSSFAQCYNVHGSYQC
KCKDGYEGDGWNCVYIPRVMIEPSGPIHVPMGNNTGLKGDGGHTNWIPDVGSTRWPLKTP
YIPPVITSRPTAKPTTRPTPKPTRQPTPPPPPPPLPTEFLTPPPPPTPERPSTRVTTIAP
TTSTSSGITVDNRIQTDPQKPRGDVFIPRQPSNDLFEIFEIERGISADDEAKDDPGVLVH
SCNFDHGLCGWIREKDSDLHWEPIRDPAGGQYLTVSAAKAPGGKAARLVLPLGHLLHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGAHGAALWGRNGGHGWRQTHITLRGADIKSVIFKGE
KRRGHTGEIGLDDVSLKKGHCSEER
Download sequence
Identical sequences ENSDORP00000009369 ENSDORP00000009369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]