SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009406 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009406
Domain Number 1 Region: 404-517
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.28e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000663
Further Details:      
 
Domain Number 2 Region: 60-262
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.04e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009406   Gene: ENSDORG00000010007   Transcript: ENSDORT00000010006
Sequence length 518
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1379:4691:31618:-1 gene:ENSDORG00000010007 transcript:ENSDORT00000010006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSASLRRAARASTRFPLLAPAPTGAPHTRARAMECQQEPQPQYPPPAPGDVAS
FDYLVIGGGSGGLASARRAAELGARAAIVESHKLGGTCXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSHIEIIHGHAAFTDGPQPMV
EVNGKKYTAPHILIATGGKPSHPDESQIPXXXXXXXXXXXXXXXXXXXRSVIVGAGYIAV
EIAGILSALGSKTSLMIRHDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXAIAAGRKLAHRLFECKEDSKLNYDNIPTVVFSHPPIGTV
GLTEDEAVHKYGKDNVKIYSTTFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGC
DEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences ENSDORP00000009406 ENSDORP00000009406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]