SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009410 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009410
Domain Number 1 Region: 591-931
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.7e-107
Family PDEase 0.00000253
Further Details:      
 
Domain Number 2 Region: 225-408
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-35
Family GAF domain 0.0000000132
Further Details:      
 
Domain Number 3 Region: 395-487
Classification Level Classification E-value
Superfamily GAF domain-like 1.26e-18
Family GAF domain 0.0000123
Further Details:      
 
Domain Number 4 Region: 49-197
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000177
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009410   Gene: ENSDORG00000010009   Transcript: ENSDORT00000010010
Sequence length 941
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6143:4059:93902:-1 gene:ENSDORG00000010009 transcript:ENSDORT00000010010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQACGHSILCRSQQYPAARPAEPXXXXXXXXXXXXXXXXXXXXXXXXDALLSLGAVIDV
AGLRQAAKNALSAVLPKVETVYTYVLDGESQLVCEDPPHELPQEGKIWEAVISRKRLSFN
GLGSSDLPGKPLARLVAPLAPETQVLVIPLVDKEAEVVAAVILVHCGQLSDNDEWNLQAV
EKHTLVALRRVQALQQRGPSATLGEIQNSLVEVSENQKDKVEYTDQDRKILQLCGELYDL
DATSLQLKVLQYLQQETQASRCCLLLVSEDNLQLSCKVLGDKVLGEEISFPLTMGRLGQV
VEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDLFT
DLDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIIT
EARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIP
DAYAHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSN
FACFTYTPRSLPXXXXXXTISMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMH
AFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYS
SEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDL
QKMAEVGYDQTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSH
KFTIRGLPSNNSLDFLDEEYEVPDLDGTRGPVNGCCSLDAE
Download sequence
Identical sequences ENSDORP00000009410 ENSDORP00000009410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]