SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009434 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009434
Domain Number 1 Region: 182-435
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.93e-93
Family Fibrinogen C-terminal domain-like 0.000000000196
Further Details:      
 
Domain Number 2 Region: 30-167
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 4.25e-56
Family Fibrinogen coiled-coil and central regions 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009434   Gene: ENSDORG00000010037   Transcript: ENSDORT00000010036
Sequence length 467
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_7712:40336:46745:-1 gene:ENSDORG00000010037 transcript:ENSDORT00000010036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSWHPRSFLLCFSTFSLLSSAGLAYVATKDNCCILDERFGSFCPTICGIADFLSSYQT
NVNKDLESLEDILRHVENRTTEAKELIKAIQVSHNPDEPAKPNMIESATMNSKKMVEEIM
KFEALLLTHESSIRFLQDIYNSNNQKINILKQKVAQLEAQCQEPCKDTVKIHDKTGKVKI
HPLPPPTSSDCQDIANKGAKESGLYFIKPLKAKQQFLVYCEIDGSGNGWTVLQKRVDGSV
DFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVQLTDWSGRTSTADY
AMFKVGSEADKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTWDNDNDKF
EGNCAEQDGSGWWMNKCHAGHLNGIYYQGGTYSKASTPNGYDNGIIWATWKSRWYSMKET
TMKIIPFNRLSIGEGQQHHMGGAKQVSTEHEAEIELEEYELLPGDYL
Download sequence
Identical sequences ENSDORP00000009434 ENSDORP00000009434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]