SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009436 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009436
Domain Number 1 Region: 1339-1645
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.38e-110
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000001
Further Details:      
 
Domain Number 2 Region: 1615-1902
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.26e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000931
Further Details:      
 
Domain Number 3 Region: 322-516
Classification Level Classification E-value
Superfamily Fibronectin type III 3.6e-45
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 514-711
Classification Level Classification E-value
Superfamily Fibronectin type III 2.07e-42
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 5 Region: 823-1015
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-37
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 6 Region: 701-827
Classification Level Classification E-value
Superfamily Fibronectin type III 4.76e-22
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 7 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-18
Family I set domains 0.0041
Further Details:      
 
Domain Number 8 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.47e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 234-328
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 1023-1145,1205-1251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009436   Gene: ENSDORG00000010031   Transcript: ENSDORT00000010038
Sequence length 1910
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4091:56167:451577:-1 gene:ENSDORG00000010031 transcript:ENSDORT00000010038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHITRPLLLLLAFFLRVDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
XXXXGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEEPYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIASYELVYKDGELGEEQRVTIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTTEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYIAVDGEDDKPH
EVLGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSILIRTDEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQXXXXXX
XXXDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
VGFGEEMVKEITVPEEIPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLHPLEQLLVPADTSMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGVLAVVFIICIVFAILLYKRKRAESESRKSSIPNSKEVPSHHPTDPVEL
RRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNK
PKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWR
MIWEQRSATIVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALY
KNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTG
CFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVP
ARNLYAYIQKLTQIETGENVTGMELFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYE
STRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVM
LTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQ
FQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLE
RMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSDORP00000009436 ENSDORP00000009436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]