SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009444 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009444
Domain Number 1 Region: 85-423
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.76e-82
Family Neutral endopeptidase (neprilysin) 0.000000079
Further Details:      
 
Domain Number 2 Region: 500-685
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-74
Family Neutral endopeptidase (neprilysin) 0.000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009444   Gene: ENSDORG00000010046   Transcript: ENSDORT00000010046
Sequence length 685
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3480:11:27256:-1 gene:ENSDORG00000010046 transcript:ENSDORT00000010046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSESPVGIMERAGGPGKRRGFPPWGLLPPLLLVTCALVVVGVLYSRGKQLPSFTSWLC
FSQEEKTVVKRKSRAIQQPAPMDEVCTTPGCVTTAARILQNMDPTKKPCEDFYQYACGGW
LRRHVIPETHSRYSVFDILRDELEVILKGVLENSTAKDRPAVEKAKILYRSCMNEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPKWELERQLAVMNAQFNRRVLIDLFIWNDDQN
SSRHIIYIDQPTLGMPSREYYFNEGSNQKVREAYLQFMMSVATMLRKDMNLPKDSQLVQQ
DMAQVLELETHLANATAPQEERHDVTTLYHRMDLEELQYKFSLKGFNWTLFIQTVLSSVK
IELLPNEEVVVYGSPYLQNLEDIIDVYSARTMQNYLVWRLVLDRISSLSQRFKDARVNYR
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXALNIQEQIGYPDYILEDTNNHDEEYSGLNFSEDLYFENGLQNL
KASAQRSLKKLREKVDQNLWIIGAAVVNAFYSPNRNQIVFPAGILQPPFFSKEQPQALNF
GGIGMVIGHEITHGFDDNGRNFDKNGNMLDWWSNFSAQHFREQSECMIYQYGNFSWDLAD
DQNINGFSTLGENIADNGGVRQAYK
Download sequence
Identical sequences ENSDORP00000009444 ENSDORP00000009444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]