SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009458 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009458
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-34
Family MAM domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-33
Family MAM domain 0.0031
Further Details:      
 
Domain Number 3 Region: 170-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009458   Gene: ENSDORG00000010061   Transcript: ENSDORT00000010061
Sequence length 346
Comment pep:novel scaffold:dipOrd1:scaffold_5448:10255:16240:1 gene:ENSDORG00000010061 transcript:ENSDORT00000010061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFEANSCGWFEAIGGDHFDWLWSSPSDLPADFEQQAPPRDHTHNTTQGHFMFILKNSSS
LSQVAKLQSPTFSQTGSGCTLSFWFYNYGLSVGAAELQLHVENSNDSTAIWRVLYNQGHQ
WSQAAIQLGRLTQPFYLSLEKVSLGIYNGVSAIDDIRFENCTLPSPSESCEGPDHFWCRH
SKACVEKLQLCDLVDDCGDGSDEADCAPELQCNFEHGICNWEQSTEDDFDWTRNQGSTST
LNTGPMKDNTLGTSKGHYLYIESSEPQAFQNHASLLSPILNATSPSGCTFRLYYHMFGKH
IYRLAIYQRIWSNSKGQLLWQIFGDQGNRWIRKQLNVSSGQPFQVW
Download sequence
Identical sequences ENSDORP00000009458 ENSDORP00000009458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]