SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009491 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009491
Domain Number 1 Region: 110-195
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000103
Family C-type lectin domain 0.0066
Further Details:      
 
Domain Number 2 Region: 25-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009491
Domain Number - Region: 270-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family VWC domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009491   Gene: ENSDORG00000010097   Transcript: ENSDORT00000010098
Sequence length 548
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_522:20139:279390:-1 gene:ENSDORG00000010097 transcript:ENSDORT00000010098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGAIHCIPLLWQCDGLAACEDK
SDEADCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLGKCPTGWH
HYEGTASCYRVYLSGENYWDAAQTCQRVNGSLATFSTDQELRFVLAQEWDQPERSFGWKD
QRKLWVGYQYVITDRNHSLEGRWEVAFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHG
GEEMCVAALCERPQGCQQYRKSKECCKFMCLDPDGNSLFDSMASGMRLVVSCISSFLILS
LLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEGG
TFHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPADDDAFEPEETGLPTPGD
SSIEGALPRCLEQPLPPAGTSLADLEDSTDSSSTLLVPPDSAQIGSAPAAEPPPGGSHHS
RGSLNTVV
Download sequence
Identical sequences ENSDORP00000009491 ENSDORP00000009491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]