SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009508 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009508
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.27e-62
Family Calnexin/calreticulin 0.0000505
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.85e-46
Family P-domain of calnexin/calreticulin 0.000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009508   Gene: ENSDORG00000010117   Transcript: ENSDORT00000010116
Sequence length 417
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_14293:11228:15828:-1 gene:ENSDORG00000010117 transcript:ENSDORT00000010116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPVPLLLGLFGLAIAEPAVYFKEQFLDGDDWTSRWIESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGNLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDNFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDKDEDEEEEEDKEEEEEEEAAGQAKDEL
Download sequence
Identical sequences A0A1S3GLV8
ENSDORP00000009508 XP_012889680.1.60039 ENSDORP00000009508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]