SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009510 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009510
Domain Number 1 Region: 211-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.76e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000236
Further Details:      
 
Domain Number 2 Region: 9-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000304
Family Biotin repressor-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009510   Gene: ENSDORG00000010118   Transcript: ENSDORT00000010118
Sequence length 507
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_14293:22890:30441:1 gene:ENSDORG00000010118 transcript:ENSDORT00000010118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPVAEQLLRRLEAADGGLDSAELAAQLGVEHQAVVGAVKSLQALGEVIEAELRSTKR
WELTAEGEEMAREGSHEARVFQSVPAEGLAQSELMRLPSGKVGFSKAMSNKWIRVDKSAA
EGPRVFRTVEGIDDEVQRRLQLVQGGQAEKLAEKERSELRKRKLLTEVTLKTYWVSKGKA
FSTSISKQEAELSPDMISSGSWQNRSFKPYNFAARGVPPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH
SQGGYGSQGYKYSWKLDEAKKNLLRTHTTSASARALYRLAQKKPFTPAKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLNLGHLMGVLREFFTKLGITQLRFKPAYNPYTEPSMEVF
SYHQGLKKWVEVGNSGLFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDVDTPRHTQEAA
Download sequence
Identical sequences A0A1S3GN85
ENSDORP00000009510 ENSDORP00000009510 XP_012889709.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]