SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009513 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009513
Domain Number 1 Region: 10-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-56
Family Eukaryotic proteases 0.0000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009513   Gene: ENSDORG00000010121   Transcript: ENSDORT00000010121
Sequence length 256
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5260:113735:148790:-1 gene:ENSDORG00000010121 transcript:ENSDORT00000010121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVRHSTQDVPETNARVVGGTEAQRNSWPSQILQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXALTFRVVVGDHNLYQNDGTEQYLSVQKIVVHEKWNSNNVAAGYDIALLRLAQSVT
LNSYVQLGVLPQEGTVLPNNTPCYITGWGRTRTNGQLAQTLQQAYLPSVDYSICSSSSYW
GSTVKRSMVCAGGDGVRSGCQGDSGGPVHCLVNGQYSVHGVTSFVSSLGCNVSRKPTVFT
RVSAYISWLNNVIASN
Download sequence
Identical sequences ENSDORP00000009513 ENSDORP00000009513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]