SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009524 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000009524
Domain Number - Region: 1-52
Classification Level Classification E-value
Superfamily L domain-like 0.000269
Family Ngr ectodomain-like 0.071
Further Details:      
 
Domain Number - Region: 82-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009524   Gene: ENSDORG00000010132   Transcript: ENSDORT00000010132
Sequence length 155
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3188:2550:5640:1 gene:ENSDORG00000010132 transcript:ENSDORT00000010132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDLQNCSLKNPGPNFPQARTAVIIDLQANPLKDNLTNTFHGFTQLQTLVLPQDVICPGGI
NAWVHITSYVDSQVCQGQKDLCNSTGNPEMCPENGSCAPAGPGLLQCVCEDGFHGYKCMR
QGSFSLLMFFGILGSTTLSISILLWGTQRRKAKTS
Download sequence
Identical sequences ENSDORP00000009524 ENSDORP00000009524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]