SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009547 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009547
Domain Number 1 Region: 104-293
Classification Level Classification E-value
Superfamily vWA-like 2.37e-60
Family Integrin A (or I) domain 0.0000662
Further Details:      
 
Domain Number 2 Region: 1150-1353
Classification Level Classification E-value
Superfamily vWA-like 7.15e-57
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 408-592
Classification Level Classification E-value
Superfamily vWA-like 2.08e-56
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 4 Region: 2339-2479
Classification Level Classification E-value
Superfamily vWA-like 3.42e-40
Family Integrin A (or I) domain 0.00056
Further Details:      
 
Domain Number 5 Region: 609-778
Classification Level Classification E-value
Superfamily Fibronectin type III 3.4e-25
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 790-961
Classification Level Classification E-value
Superfamily Fibronectin type III 5e-22
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 7 Region: 1731-1818
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-20
Family Fibronectin type III 0.00081
Further Details:      
 
Domain Number 8 Region: 2496-2698
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-19
Family SPRY domain 0.079
Further Details:      
 
Domain Number 9 Region: 1540-1627
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-18
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 10 Region: 2003-2090
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-18
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 11 Region: 977-1151
Classification Level Classification E-value
Superfamily Fibronectin type III 5.24e-18
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 12 Region: 307-397
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-17
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 13 Region: 1820-1908
Classification Level Classification E-value
Superfamily Fibronectin type III 5.41e-17
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 14 Region: 1-84
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000202
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 15 Region: 2184-2267
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000252
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 16 Region: 1915-1952
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000295
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 17 Region: 2139-2179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000664
Family Fibronectin type III 0.005
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009547
Domain Number - Region: 1404-1447
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000225
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number - Region: 1673-1718
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000656
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009547   Gene: ENSDORG00000010155   Transcript: ENSDORT00000010156
Sequence length 3040
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1757:6591:126310:-1 gene:ENSDORG00000010155 transcript:ENSDORT00000010156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPPSDLNFKIIDENTVHMSWARPVDRIKGYRITVDPTTDGPTKEFTLSASTVETLLSNLI
PEIEYIVTITSYNEVEESVPVIGQLTIQTGGPTKPGEKKPGKAEIQKCSVSAWTDLVFLV
DGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVGVVQYSSDTRTEFNLNQYYQRDELLA
AIKKIPYKGGNTMTGDAIDYLVKNTFTESSGARVGFPKVAIIITDGKSQDEVEIPARELQ
NIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVANFDAIVDIQNEIISQVCSGVDEQLG
ELVSGEEVVEPPSNLVALEVSSKYVKLRWDPSPSAVTGYKVLLTPLAPGSRQHALSVGPQ
TTSLNVRDLSSDTEYQISVSAMKGLTSSEPVSILEKTQPMKVQVECSRGVDIKADIVFLV
DGSYSIGIANFVKVRAFLEVLAKSFEISPNRVQISLVQYSRDPHTEFTLKEYNRVEDIIK
AINTFPYRGGSTNTGKAMTYVREKIFVPNKGSRSNVPKVMILITDGKSSDAFRDPAIKLR
NSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVEDFDAFQRISFELTQSICLRIEQELA
AIKKKAYVPPRDLRFSDVTSSSIKADWSPAGDNVFSYHITYKEASGDDEATVVEPASSTS
VVLSNLKPETLYLVNVTAEYEDGFSTPLTGEETTGEVKGTPRNLKVTDETTDSFKITWTQ
APGRVLRYRIKYRPVTGGESKEVTTPANQRRRTLDHLTPDTKYEISVIPEYSSGPGSPLT
GNAATEEVRGNPRDLRVSDPTTSSLKLSWSGAPGKVKQYLVTYTPAAGGATEEATVRGDT
TTTVLRSLKEGTQYTLSVTALYASGAGDALYGEGTTLEERGSPQDLVTKDITDTSIGAYW
TSAPGMVRGYRVSWKSLYDDVETGEKILPGDAIHTMIENLQPETKYRISVFATYNSGEGD
PLTGDATTELSRDAKTLKVDEETEHTMRVTWKPAPGRVINYRVVYRPHGGGRQMVAKVPP
TVSSTVLKRLQPQTTYDITVLPMYKTGEGKVRQGSGTTASRFKSPRNLKTSDPTMSSFRV
TWEPAPGEVKGYKITFHPTGDDRRLGELVVGPYDNTVVLEELRAGTTYKVNVFGMFDGGE
SSPLVGQEMTTLSDTTVMPVLSSGMECLTRAEADIVLLVDGSWSIGRANFRTVRSFISRI
VEVFEIGPKRVQIALAQYSGDPRTEWHLNAHRDKKSLLQAVANLPYKGGNTLTGMALNFI
RQQSFKAQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKM
IATDPDDIHAYNVADFGSLSSIVDDLTINLCNSVKGPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFYVSRLDTSTVLKDLKPETEYVVNVYSVVEDEYSEP
LKGTEKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPQPQDLRLRDVTHSSMNVV
WEPVLGKVRKYLVRYKTPEEDFKQVEVDRSRASTTLKDLFSQTQYTVSVSAVYDEGESPP
ATEQETTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILNGD
ENTLVFENLNPNTLYDVSITAIYPDESESDDLTGSERTLRLIPLTTQAPKSGPRNLQVYN
ATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQTTTIGGRQSSVVLQRLKPDTPYTITV
SSLYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTSTLSVRWDHAEGNPRQYKLFYAPTAG
GPEELVPIPGNTNYAILRNLQPDTPYTITVVPVYTEGDGGRTSDTGRTLVRGLARNVQVY
NPTPNSLDVRWDPAPGPVQQYRIVYTPVAGTRPSESXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXPRSGPRNLRVFDETTNSLSVAWDHADGPVQQYRIIYSPTV
GDPIDEYTTVPGRRNNVILQPLLPDTPYKITVIAIYEDGDGGHLTGNGRTXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNEPMEAFVGEVTSYTLHNLNPSTTYDVS
VFAQYDSGLSVPLTDQGTTLYLNVTDLKTYQVGWDTFCVKWSPHRAATSYRLKLSPADGT
RGQEITVRGSETSHCFTGLSPEAEYGVTVFVQTPNLEGPGVPVKEHTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
SFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGGNTRTGKALTFIKEKVLTWESGMRK
NVPKVLVVVTDGRSQDEVKKAAFIIQQSGFSVFVVGVADVDYNELANIASKPSERHVFIV
DDFESFEKIEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEKNFASVQGVSLE
SGSFPSHSAYRLQKNAFISQPTAELHPNGLPPSYTIILLFRLLPETPNDPFAIWQITDRD
YKPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTDEVKTLFYGSFHKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXITTDGHEILGKLLKGERKSATFQIQNFDIVCSPVWTSRDRCCDI
PSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGPGAKGPRGERGINGAIGPPGPRGDTG
PPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGLPGRSGTPGLPGPPGPTGPPGDRGF
TGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRPGQSGLKGEKGDRGDIASQNM
MRAVARQVCEQLISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGIGSPGSRGPPGPPGPQGESRTGPPGSTGSRGPP
GPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPGSG
Download sequence
Identical sequences ENSDORP00000009547 ENSDORP00000009547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]