SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009566 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009566
Domain Number 1 Region: 1593-1706
Classification Level Classification E-value
Superfamily C-type lectin-like 2.59e-45
Family Noncollagenous (NC1) domain of collagen IV 0.000000534
Further Details:      
 
Domain Number 2 Region: 1486-1592
Classification Level Classification E-value
Superfamily C-type lectin-like 1.93e-42
Family Noncollagenous (NC1) domain of collagen IV 0.000000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009566   Gene: ENSDORG00000010175   Transcript: ENSDORT00000010175
Sequence length 1707
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2927:43693:187847:1 gene:ENSDORG00000010175 transcript:ENSDORT00000010175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRGPTTAPGAALRRWLLLGAATLCLARGVLAGVKKFDVPCGGRDCSGGCQCYPEKGGRG
QPGPVGPQGFSGPPGLQGFPGLQGRKGDKGERGAPGTTGPKGDVGARGVSGFPGADGIPG
HPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGSPGPQGPKGQKGEPYALSEEDRGK
YRGETGEPGLVGFQGPPGRPGPVGPMGPVGAPGRPGPPGPPGPKGQPGNRGLGFYGEKGE
KGDIGQPGPNGIPSDTTLIGPTTTTYRPDQYKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFLFGLKGAGGRVGYPGPSGFPGTRGQKGWKGDSGDC
KCADDFPGGLPGRPGPKGFPGINGEPGRKGQQGDPGQHGIPGFPGFKGAPGLAGIPGPKG
IKGDSRTVTTKGERGQPGVPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDSGY
PGIPGAKGFPGEVGPPGLGLPGPKGERGFPGDAGLPGPPGFQGPPGPPGTPGQIDCDTGV
KRPIGGDGQDAVHPDCVGGPQGSPGLQGFPGPAGAKGLRGIPGFPGADGAPGLKGFPGDP
GREGFPGPPGFMGPRGSKGAAGLPGPDGFPGPIGLPGPAGPPGDRGLPGEVLGAQPGPRG
DAGLPGHPGLKGLPGDVGPPGFRGSQGMPGVPGLKGQLGLPGPSGHPGPTGPPGRHGFPG
APGQGGPPGLPGAPGLGGLPGDRGEPGDTGAPGPVGMKGLSGDRGEAGFLGEQGHRGNPG
FKGMAGMPGSPGQKGERGSPGMDGFQGMIGLTGRPGFPGSKGEAGFFGIPGLKGLPGQPG
VKGNRGDPGPPGPPPIILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGLAGIPGL
PGRPGHIKGTKGDIGVPGVPGLPGFPGVSGPPGIVGFPGFTGSRGDKGAPGREGLYGETG
QTGDLGDVGDTIDLPGSPGLKGERGLTGTPGVKGFFGEKGTEGDVGFPGITGLTGAQGPP
GPKGQSGFPGLAGLQGPQGDPGRIGVPGEKGDYGWPGXXXXXXFPGFRGIGGLHGLPGTK
GFPGAPGADIHGDPGLPGPIGERGEPGEANTLPGPVGAPGQKGQQGVPGERGPAGSPGLQ
GFPGISPPSNISGLPGDVGAPGIFGLEXXXXXXXXXXXXXXXXXXXXXXXXGASGITGSK
GWVGDPGPQGRPGVFGLPGEKGPKGEPGLMGNTGPSGPVGDRGPKGPKGDQGFPGAPGSV
GSPGIAGQPPKFAVQPGALGPQGRRGPPGAQGEMGPQGPPGEPGFRGTPGKAGPQGRGGV
SAVPGFRGDQGPMGHQGPIGQEGEPGRPGSPGLPGMPGRSTSIGYLLVKHSQTDQEPMCP
VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSY
WLSTTAPLPMMPVAEDEIQPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLWIGYSF
LMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTIPEQSFQ
SSPSADTLKAGLIRTHISRCQVCMKNL
Download sequence
Identical sequences ENSDORP00000009566 ENSDORP00000009566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]