SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009580 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009580
Domain Number 1 Region: 321-446
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.23e-27
Family Ankyrin repeat 0.00084
Further Details:      
 
Domain Number 2 Region: 57-131
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.79e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 3 Region: 4-52
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000365
Family ZZ domain 0.014
Further Details:      
 
Domain Number 4 Region: 779-834
Classification Level Classification E-value
Superfamily RING/U-box 0.000000471
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009580   Gene: ENSDORG00000010192   Transcript: ENSDORT00000010192
Sequence length 839
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6418:2841:12197:1 gene:ENSDORG00000010192 transcript:ENSDORT00000010192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKHGLRGMRWKCRVCFDYDLCTQCYMHSKHDLAHAFERYETAHSRPVTLSPRQGLSRIPL
RGIFQGAKVVRGPDWEWGSQDGGEGKPGRVVDIRGWDVETGRSVASVTWADGTTNVYRVG
HKGKVDLKCVGEAAGGFYYKEHLPRLGKPAELQRRVSADSQPFQRGDKVKCLLDTDVLRD
MQEGHGGWNPRMAEFIGQTGTVHRITDRGDVRVQFNHETRWTFHPGALTKHHPCDSGWAF
KQKWXXGRVGKVVKVFGDGNLRVAVGGQRWTFSPSCLVAYRREEDANLDVAERARENKSS
LSMALDKLRAQKNDPEHPGKLVVEAALGNVARALDLLRRHPEQVDTKNQGRTALQVAAYL
GQVELVRLLLQARAGTDLADEDGNTALHYAALGNQPEAARMLLSAGCGADVLSGSRSTAL
HVAVQRGFLEVVKTLCERGCDVNLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXCARRRKCIRCQVVISKKLRPHGSEVAGAASALGPPRQLVE
ELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences ENSDORP00000009580 ENSDORP00000009580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]