SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009584 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009584
Domain Number 1 Region: 476-651
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.44e-61
Family Extended PAW domain 0.0000000836
Further Details:      
 
Domain Number 2 Region: 14-115
Classification Level Classification E-value
Superfamily PUG domain-like 9.29e-32
Family PUG domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 292-333
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.43e-17
Family Transglutaminase core 0.00031
Further Details:      
 
Domain Number 4 Region: 383-446
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000249
Family Transglutaminase core 0.0000425
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009584
Domain Number - Region: 148-217
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000523
Family Transglutaminase core 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009584   Gene: ENSDORG00000010195   Transcript: ENSDORT00000010196
Sequence length 653
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3947:15616:66578:-1 gene:ENSDORG00000010195 transcript:ENSDORT00000010196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALGSASGSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTA
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSDKSF
KVGSSQQQASGTQILTTQSSNLNESQYPGNHQGQSSHSLSAPKVIADSAILKVLQSNIQH
VLLYENPALQEKALTCIPVKELKRKSQEKLSRARKLDKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNDPEKL
LETRCGRCGEWANCFTLCCRALGFEARYVWDYTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVVDVTWRYSCKHEEVISRRTEVKEDLLRETINGINKQR
QLSLSENRRKELLHRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLERKETLF
IPSENEKMSKHFHLCYNIVKNHYVRVSNNNQTISGWENGLWKMESIFRKVETDWNMVYLA
RKEGSSSAYISWKFECGSVGLKVDSISIRASSQTFETGTVRWKLRSDSTHIDLTGDKNLQ
LYKDFSGATEVILEAELSKGDGDAAWQHTQLFRQSLNDHEENGLEIIIKLTEL
Download sequence
Identical sequences ENSDORP00000009584 ENSDORP00000009584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]