SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009637 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009637
Domain Number 1 Region: 115-286
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-63
Family Fibrinogen C-terminal domain-like 0.00000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009637   Gene: ENSDORG00000010254   Transcript: ENSDORT00000010253
Sequence length 291
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1388:24392:39517:-1 gene:ENSDORG00000010254 transcript:ENSDORT00000010253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALENCSQELARLRSQVHQLETRVKLQQVTIGQLLHEKEVQFLDKGQETNIIDIGGKRQYA
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWSDYE
NGFGNFVRRNGEYWLGNKNLHLLTIQGDYTLKIDLEDFEKKSRYAQYKNFQVGDEKNSYE
LNIGEYSGTAGDALSGNFHPEVQWWAGHQRMKFSTWDRDNDNYEGNCADEDQSGWWFNRC
HSANLNGIYYQGPYTAQTDSGIVWYTWHGWWYSLKSVVMKIRPNDFIANIL
Download sequence
Identical sequences ENSDORP00000009637 ENSDORP00000009637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]