SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009648 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009648
Domain Number 1 Region: 157-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-16
Family SPRY domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009648
Domain Number - Region: 69-103
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0706
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009648   Gene: ENSDORG00000010264   Transcript: ENSDORT00000010264
Sequence length 265
Comment pep:novel scaffold:dipOrd1:scaffold_3992:387:9844:1 gene:ENSDORG00000010264 transcript:ENSDORT00000010264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKCKNMEHILQQKVRTFSSTRSSYEALAKHNQVETTWLEGRIHQEFEKLQEFLRVEEKAT
LDMMTQESRQKQLLIDERVKQLSREVEALNREVKRLKVEMREDDISFLLKHKTRKRRLFY
TLEPEPIQPGMLIDVCKYLGSLQYRTWKKMISFIEVVPITLDPNTASGWLSVHDDLASVS
NQPYWRQVENPDRFSSAPALMGSQVFSQGSHAWEVSVDGLQWRSVMRVSAEECNTSNCFY
HTSSGFWYMYHMQGLEDDMITLKRG
Download sequence
Identical sequences ENSDORP00000009648 ENSDORP00000009648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]