SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009670 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000009670
Domain Number - Region: 408-457
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0576
Family Transglutaminase, two C-terminal domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009670   Gene: ENSDORG00000010287   Transcript: ENSDORT00000010287
Sequence length 731
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6150:22293:29724:-1 gene:ENSDORG00000010287 transcript:ENSDORT00000010287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFERPHPGEDPQLGGPIGEVELSTCNPPAGVPEKPAAPRFLPVLCCMFPPGARDPHGH
SQGHGGFVLKEALFGLLFGADATLLESPVILCGLPDGQLCCVVLKALATSRSAPGDPKAL
VKILHHLEEPAVFIGALKTERPAEEAAEEVLPEEGQHSDCLVALGHQGRALAIKASWNES
GSLVPELREYWLPGPMLCAACGAGGRVYLSTPLDLCVVDLAQGSAPSDPQQPHRDLGSLP
LELCPTSLSICSVLTLSVSSRTPAGGTELLALTAKGRLVSCSVDLNSKKTDSARVSVANA
GQRIKELLSGIGDISERVSFLKKAVDQRNKALTSLNEAMNVSCALLSSREGPRPVSCTTT
TAWSRVQLQDVLMATCLLENSSCFSLERGWTLCVQVLASASALDLGAAGPAVTYTIPVDS
LGPGSRREVTLPLGPSESGEFKLPVTVSCTLFYSLREVVGGALAPADPLEAPFLEEQPLD
LLPEQEGICLPLSKHTVDMLQCLRFPSLVAAHTQAPRLPGPAHDPVDAFLETCQPPSSQP
SGPASLRAKYLPPSSASVRVSAELLRAALEAARSGVPLCSATLQWLLAENPAVDIIRARA
LSSIQGVAPDGTDIHLVISEVAVTDLSPAGPIQAVDIQVESPSLADMCRAHHAIVGRMQA
MVTEQAAQGASAPDLRLQYLRQIHTNHEALLREVQALRDRLCTEDEASSCATAQRLLQVY
KQLRNPSLVLL
Download sequence
Identical sequences ENSDORP00000009670 ENSDORP00000009670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]