SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009713 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009713
Domain Number 1 Region: 33-123
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.83e-28
Family Inhibitor of apoptosis (IAP) repeat 0.0004
Further Details:      
 
Domain Number 2 Region: 326-344,550-587
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.000000157
Family Inhibitor of apoptosis (IAP) repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 166-208
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 0.000000183
Family Inhibitor of apoptosis (IAP) repeat 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009713
Domain Number - Region: 449-478
Classification Level Classification E-value
Superfamily DEATH domain 0.0942
Family Caspase recruitment domain, CARD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009713   Gene: ENSDORG00000010334   Transcript: ENSDORT00000010333
Sequence length 612
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1683:1835:11972:1 gene:ENSDORG00000010334 transcript:ENSDORT00000010333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKTTSQAGPIYQRCIMEDRTFLSNWTEDKQKMKYDFSCELYRMSTYSTFPTGVPVSERS
LARAGFYYTGVKDKVKCFCCGLMLDNWKRGDSPAGKHKQLYPSCSFAQSLTSATLQSTSK
NTSPVRSASAHSLSPPLEHSSLFSGSYSSLPPNPLHSRAVEDLSPLRTNLYSYAMSTEEA
RVLTYNGWPLNLLSPLELARAGIYYIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXCEFLICMKGQEFVDEIQARYPHLLEQLLSTSDTA
GEENADTPIVRFGHGESSSEDAVMMNTPVVKAALEMGFSRSLVRQTVQSRILTTGENYKT
VNDIVSALLNAEDERREEEKEKQAEEIASDDLSLIRKNRMALFQQLTCVLPILDNLLKAX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKNMK
YIPTEDVSGLSLEEQLRRLQEERTCKVCMDREVSVVFIPCGHLVVCQECAPSLRKCPICR
GLIKGTVRTFLS
Download sequence
Identical sequences ENSDORP00000009713 ENSDORP00000009713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]