SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009716 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009716
Domain Number 1 Region: 235-337
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.56e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 
Domain Number 2 Region: 53-100
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000471
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009716   Gene: ENSDORG00000010339   Transcript: ENSDORT00000010337
Sequence length 344
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3671:3650:106903:-1 gene:ENSDORG00000010339 transcript:ENSDORT00000010337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGLLLLTSALAGQRLGAQAESNLSSKFQFSSDKEQNGVQDPQHERVITVSSNGSIHS
PRFPHTYPRNMVLVWRLVTAENMWIQLTFDERFGLEDPEDDICXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVTEAVSPTVLPPSAL
PLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLL
KEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKV
TKKYHEVLQLRPKIGVRGLHKSLTDVALEHHEECDCVCRGNTGG
Download sequence
Identical sequences ENSDORP00000009716 ENSDORP00000009716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]