SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009747 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009747
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.25e-25
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000883
Further Details:      
 
Domain Number 2 Region: 407-491
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.02e-17
Family Ricin B-like 0.0079
Further Details:      
 
Domain Number 3 Region: 305-362
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000534
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009747   Gene: ENSDORG00000010372   Transcript: ENSDORT00000010372
Sequence length 497
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3557:119540:159793:1 gene:ENSDORG00000010372 transcript:ENSDORT00000010372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRSIPDTRHDQCQRKQWRVD
LPATSVVITFHNEARSALLRTVVSVLKRSPPHLIREIILVDDYSSDPDDGALLGKIEKVR
VLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXFEWNLVFKWDYMTPEQRRARQGNPVAPIXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVY
PELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEWALTKEKSVKHMD
LCLTVVDRVPGSLIRLQGCRENDGRQKWEQIEGNSKLRHVGSNLCLDSRAAKSGGLRVEV
CGPALSQQWKFSLNLQQ
Download sequence
Identical sequences ENSDORP00000009747 ENSDORP00000009747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]