SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009781 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009781
Domain Number 1 Region: 8-212
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.08e-61
Family Eukaryotic proteases 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009781   Gene: ENSDORG00000010411   Transcript: ENSDORT00000010409
Sequence length 212
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_51129:1473:4991:1 gene:ENSDORG00000010411 transcript:ENSDORT00000010409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGFSLCSVPKKKDLQSVCGQPVFSSRIIGGQDAAIRRWPWQVSLHLDRAPICGGSLISKN
WILTAAHCLPKTSAYSYSVWLGSLKADASNKGKVYYVSRIVIHPKYDGSNADIALLRLSS
QVTFSADILPICLPSTSKQLKIPASCWVTGWGLVKENNYPHTLQEAEVPVFTRQECEQLY
NPIGGFLPALESVIKEDMICAGDIINKKDSCK
Download sequence
Identical sequences ENSDORP00000009781 ENSDORP00000009781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]