SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009823 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009823
Domain Number 1 Region: 676-809
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-44
Family C-type lectin domain 0.00000531
Further Details:      
 
Domain Number 2 Region: 151-266
Classification Level Classification E-value
Superfamily C-type lectin-like 2.16e-42
Family Link domain 0.0058
Further Details:      
 
Domain Number 3 Region: 267-368
Classification Level Classification E-value
Superfamily C-type lectin-like 7.09e-31
Family Link domain 0.0054
Further Details:      
 
Domain Number 4 Region: 803-862
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 5 Region: 101-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000357
Family I set domains 0.089
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009823
Domain Number - Region: 638-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0712
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009823   Gene: ENSDORG00000010452   Transcript: ENSDORT00000010452
Sequence length 897
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2783:10249:23352:1 gene:ENSDORG00000010452 transcript:ENSDORT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLLPLLMILALTQVPAALVGVLEGDSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXREAEVLVARGLRVKVNEAYRFRVALPAYPASLTDV
SLVLSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACT
RIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGYPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGAPPDKLTLEEARAYCRERGAEIATTGQLYAAWDDGLDR
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAHPS
TMPETSNPASDGLEAIVTVTETLEELQLPQETMESESRGAIYSIPIMEDGGGGSSTPEDP
AEAPKTLLEFETQSIVPPTGSSEEESKVLEEEESYKDEEEIEEEDKEVEDEDLWAWPSEL
SRPLPTDMDMEESLSQASPPARAVLQPGASPPPSGEPKTARPPRVHGPLTETLPTPKEGS
LASPPPSTPVGARELGEEAGGPDLSGVLRGESEETGSSEDTPSLLPATRAPEGTRELEVP
LEENSGRTVPAGTSVLAQPVLPTDSASRGGVAVAPSSGDCVPNPCHNGGTCLXXXXXXXX
XXXXXXXXXXXXXXLHFCSPGWDAFQGSCYKHFSTRRSWEEAETQCRMYGAHLASISTPE
EQNFINNQYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWH
DQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVLRYRCQEGLAQ
RNLPLIRCQENGLWEPPQISCVPRRPARAVHPVKKPRGYQWRQRGHQKTLLPPPSGP
Download sequence
Identical sequences ENSDORP00000009823 ENSDORP00000009823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]