SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009837 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009837
Domain Number 1 Region: 38-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-36
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 701-884
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.4e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 124-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-31
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 4 Region: 311-404
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000141
Family Laminin G-like module 0.0097
Further Details:      
 
Domain Number 5 Region: 892-996
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000696
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 6 Region: 553-603
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000598
Family Fibrinogen C-terminal domain-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009837
Domain Number - Region: 475-517
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0131
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009837   Gene: ENSDORG00000010466   Transcript: ENSDORT00000010466
Sequence length 1231
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4052:62639:240838:1 gene:ENSDORG00000010466 transcript:ENSDORT00000010466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCGGPRVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGGWSPLVSNKYQWLQIDLGERM
EVTSVATQGGYGSSNWVTSYLLMFSDSGRNWKQYRQEDSVWGFSGNANADSVVYSRLQPS
VKARFLRFLPLEWNPKGRIGMRIEVFGCAYRSEVVDLDGKSSLHYRFNQKSLSPMKDTIS
LKFKTMQSAGVLLHRAGPGGDSITLELRGGRLFLLINAGEAKLPSTHSPTNLTLSSLLDD
QHWHSVLIQTGKQVFTVDEHKSRFHAQGDFSYLXXXXXISFGGIPAPAKSVSFLHKNFHG
CLENLYYNDMDIIDLAKQQDPQIIIMGNVSFICSQPQSVPVTFLSSRSFLTLPASSREEG
VSASFQFRTWNAAGLLLFSELQVVSGSLLLLLSDGKLKLNLHQPGKLPSDIIAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPDKFGSRCRSPLAGFQ
GCMRLISINDREVDLIAVQQGSLGNFSDLQIDSCGISDXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIYEQSCEAYKHRGNTSGFYYIDADGSGPLRPFLLYCNMTETTWSI
VQHNGSDLTRVRSAHPEQPHAGVFRYPASAEQLQATIRQAEHCQQELAYYCKKSRLVDQQ
DGSPLSWWIGRTNETQTYWGGSVPELQKCTCGLEGTCIDAHYHCNCDADRNESFWNSASF
NTEASYLHFPTFQGEISADVSFFFKTTALSGVFLENLGITDFIRIELRSPTTVTFSFDVG
NGPFEISVQSPTRFNDNQWHHVRVGRNMKEASLEVDQLLPKTQPAPADGHALLQLNSQLF
VGGTATRQRGFLGCIRSLQLNGMTLDLEERAKVTPGVQPGCPGHCGSYGKLCRHGGKCRE
KPSGFFCDCSASAYTGPFCSNEISAYFGTGSSVIYNFQENYSLSKNSSSHAASFHGDMKL
SREMIEVSFRTTRSPSLLLYMSSFYKEYLSIIIARNGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXIDESTRRGVHLSSGTEFSAVKSLVLGRILXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLIAVVIFILLCITAVAIRIYQQKRLYKRNETK
RSENVDSAQAVLKSELNIQNTVNENQKEYFF
Download sequence
Identical sequences ENSDORP00000009837 ENSDORP00000009837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]