SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009839 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009839
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.42e-50
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 494-621
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.15e-34
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 3 Region: 331-402
Classification Level Classification E-value
Superfamily EF-hand 0.000016
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009839   Gene: ENSDORG00000010467   Transcript: ENSDORT00000010468
Sequence length 776
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2775:8648:29722:1 gene:ENSDORG00000010467 transcript:ENSDORT00000010468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALANRRLENLQVYKVLQCVRNKDKKQIEKLTKLGYPELINFTEPIDGLSALHLAAVAND
IDMVTFLLGLGAHPDVQDQMGCTPTMRAAELGHELSMEMLAKANADMTIVDNEGKGVLFY
CILPTKRHYRCALIALEHGADVNNVTYEGKPVFLRACEEAHDVKDMCMTFLEKGANPNAF
NSSTGRTALMEASREGVLELVREILERGGKVNAFDNERLHAAHFAAKGGYFDILKLLFAY
NGDMGIIAMNGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRAVAKDGGFKAAS
KEIRRAERIANKLAKQGDQNPNPVWALRLHDWSIEHETFLREAFAIVDKGDGTISKEDFV
QTLEERQSFANADQLAFVAQLHEKIRGGGVSINDFFKGTKYLGKAYVLGSFGPKKKKKGM
GKKGKKGKFVLPLPICVIPEQAFPGRPDGGPPYYMIEAYQNLTDCGRFTRDAPPEHPIQD
DSVWYIDDTGRIYSNINFITKAGDMASLKKAFESGIPVDMKDRYYKTPLMTACANGNIDV
VKFLLEKGANVNATDNLLWTPLHFACHAGQQDIVELLVKNGAAIDAPSINNSTPLSRAIE
SCRLDTVKYLLDMGAKFQLENRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXETLSSVYNIPAISEEKKVHKDNVVYLNSLITSGYTKKVDITF
VPRRTWSPEATTAELVKKREMRRERFTYEVDFEDFMMPFQKSITEKAKALESALKI
Download sequence
Identical sequences ENSDORP00000009839 ENSDORP00000009839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]