SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009857 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009857
Domain Number 1 Region: 23-175
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-18
Family C-type lectin domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009857
Domain Number - Region: 244-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000519
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 288-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 451-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0958
Family EGF-type module 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009857   Gene: ENSDORG00000010488   Transcript: ENSDORT00000010487
Sequence length 577
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2779:71647:73680:-1 gene:ENSDORG00000010488 transcript:ENSDORT00000010487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVLLLGVLARAGLGSSGPIEPQPSGSQCVEHECFALFRGPVNFLAASQACERLQGHLM
TVRSSVAAEVITLLQSGDSSMGPNLWIGLQLPQGCSGPGNLGPLRGFQWVTGDNHTSYSR
WARLDDGAPVCGPLCVTVSGPAASVPSDPIWEERQCTAEADGFLCEFHFAAYCRPLEANP
RNQVAAPISSTYITPFGARNADFQTLPVGSSVVVESLGLTLVCSLPSGSASGRWSREAPG
PWDCGVENGGCEYACNTSSGTPSCFCPGNLGLQADGRFCTSPPVQKCTDLCEHFCISNPS
DPDSYSCMCETGYKLAADQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGCRNLPGSFECLCGPDSPFAGQVSTDCD
PIVVNNKGYEDGSGEPPFSTRIPDSTLRPPSAGAVHSGVLIGISIASLSLVVALLALLCH
LRKKQSTARAELEYKCGSPAKEVVLQNVRTERTLQKL
Download sequence
Identical sequences ENSDORP00000009857 ENSDORP00000009857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]