SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009860 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009860
Domain Number 1 Region: 29-254
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000169
Family FAD/NAD-linked reductases, N-terminal and central domains 0.056
Further Details:      
 
Domain Number 2 Region: 23-64,277-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000124
Family FAD-linked reductases, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009860   Gene: ENSDORG00000010490   Transcript: ENSDORT00000010490
Sequence length 683
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1103:53744:70013:-1 gene:ENSDORG00000010490 transcript:ENSDORT00000010490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRLAAAATLWAPLGLLLTLAPHPARAPPHRDYCVLGAGPAGLHMASFLYRAGKDYPVFER
APRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLVA
TGLSVPNQVDFPGSELVEGYESVSTDPEDFVGQNVLILGHGNSAFETAENILGVTNFVHM
LSRSRVRLSWATHYVGDVRAINNGLLDTYQLKSLDGLLESDLTDLAFVKDRQGKFHITLK
FFLEEANASQSADSITLPQDDNDNFAMRVAYDRVIRCLGWKFDFSIFNQSLRLSSGSEFG
KKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSVA
WPSTKYPITQLTSSIIRRVNEASGLYQMFGVLADIILLNENATAFEYLEEFPVQMLAQLE
TLTGRKAQHGLFVINMEYGKNFSGPDKDVFFYDRSVGHTEDAWQSNFLHPVLYYYRHLPT
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSC
FVFSLTRQKLPPFCQLGYLSMQGLASTEGLRQHGVDSRLLRDYAAMGQHREGSSQPPGSR
GPNSHPLVPGPLVQSLDSNKEEL
Download sequence
Identical sequences ENSDORP00000009860 ENSDORP00000009860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]