SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009862 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009862
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-26
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 123-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-20
Family Laminin G-like module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009862   Gene: ENSDORG00000010492   Transcript: ENSDORT00000010492
Sequence length 303
Comment pep:novel scaffold:dipOrd1:scaffold_39385:1306:10152:-1 gene:ENSDORG00000010492 transcript:ENSDORT00000010492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEVVFSFDVGNGPCEVTLQSPTPLNDNRWHHVRAERNVKEATLRVDQLPQKMQPAPADG
PVRLQLSSQLFVGGTASRQRGFLGCIRSLRLNGVALDLEERATVTPGVELGCAGHCSSYG
HLCHNGGRCLEKHAGIQCDCASSAFEGPFCSQEVSAYFGAGSSVIYNFQEHDNNTFNNSS
SSLVESSHEELKLTREIATLSFRTTGAPSLLLYVSSFFEEHLTVVLTPDGSLQVRYKLDR
HKEPDVLDFDFKNLADGQLHRLKIHRAASVILVEVDQYARKQAILSSGTEFSAVRCLVLG
TIS
Download sequence
Identical sequences ENSDORP00000009862 ENSDORP00000009862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]