SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009882 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009882
Domain Number 1 Region: 401-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-18
Family MAM domain 0.0025
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000102
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 171-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000381
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009882   Gene: ENSDORG00000010515   Transcript: ENSDORT00000010515
Sequence length 519
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6527:15991:61198:1 gene:ENSDORG00000010515 transcript:ENSDORT00000010515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPWGLMLPLLLPWVAGGFGIAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXVCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGVKARPCQHRCVNTHGSYKCFC
LSGYMLMPDATCMNSRTCARINCQYGCEDTEEGPRCLCPSLGLRLAPNGRICLDVDECSS
GKAACPHNRRCVNTFGSYYCKCHIGFELKYISGRYDCVDINECAVNKNTCSLHAXXXXXX
XXXXXXXXXXXXXXXXXXXXIPEKSVKESRKIPGPIKDRIKKLLAHKNSMKKKLRIQTVT
PGPTGTHPPKVNLQSFSPEESVARNGHTNREKPGKEERMKEGLEEEKTLEKALKNDVEQE
RSLRGDVFSPKVNEEGDLDLVLTQRKSLNSKLEHKADLNISVDCSFDHGVCDWKQDREDD
FDWNPADRDNAVGYYMAVPALAGHKKDVGRLKLLLPGLQPQSNFCLLFDYRLAGNKVGKL
RVFVKNSNNALAWEETKNGDERWKTGKIQLYQGIDTTKS
Download sequence
Identical sequences ENSDORP00000009882 ENSDORP00000009882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]