SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009925 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009925
Domain Number 1 Region: 270-596
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-74
Family Hect, E3 ligase catalytic domain 0.00016
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.31e-31
Family APC10-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009925   Gene: ENSDORG00000010562   Transcript: ENSDORT00000010561
Sequence length 608
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2482:4104:11279:-1 gene:ENSDORG00000010562 transcript:ENSDORT00000010561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDTTDDNFMPKRVVVY
GGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDGIDVRLRGVKIKSS
RQRELGLNADLFQPASLVRYPRLEGTDPEILYRRAVLLQRFIKILDSVLHHLVPAWDHTL
GTFSEIKQVKQFLLLSRQRPSLVTQCLRDSESSKPSFMPRLYINRRLAMEHRACPSRDPA
CKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGGGFRDSLADMSE
ELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEWIGQLMGAALRGKE
FLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDRETFEFKFGKELTFTTV
LSDQQVVELIPGGTGIVVGYEDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDL
LTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDTRVQYFWEALNNFTNEDRSRFLRFVT
GRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYVSAKVCEEKLRYAAYNCVAID
TDMSPWEE
Download sequence
Identical sequences ENSDORP00000009925 ENSDORP00000009925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]