SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009928 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009928
Domain Number 1 Region: 949-1018
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.16e-18
Family TB module/8-cys domain 0.00072
Further Details:      
 
Domain Number 2 Region: 2331-2403
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-18
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 3 Region: 2052-2121
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.49e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 4 Region: 1532-1627
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-17
Family TB module/8-cys domain 0.0000096
Further Details:      
 
Domain Number 5 Region: 532-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.22e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 6 Region: 2129-2258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 718-851
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 450-575
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 9 Region: 325-391
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.23e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 10 Region: 2444-2568
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 1197-1335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000149
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 12 Region: 1689-1785
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 13 Region: 846-930
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000235
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 14 Region: 1075-1200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000306
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 1847-1973
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000447
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 16 Region: 651-721
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000536
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 17 Region: 2570-2683
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000942
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 179-229,286-306
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000327
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 19 Region: 1606-1655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000207
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 20 Region: 1030-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000021
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 21 Region: 2007-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000036
Family EGF-type module 0.005
Further Details:      
 
Domain Number 22 Region: 1967-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000371
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 23 Region: 2284-2332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000441
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 24 Region: 2402-2450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000444
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 25 Region: 1322-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000457
Family EGF-type module 0.019
Further Details:      
 
Domain Number 26 Region: 1767-1819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000561
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 1448-1494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000158
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 28 Region: 1809-1845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000183
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 29 Region: 1642-1691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 30 Region: 1368-1405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000483
Family EGF-type module 0.038
Further Details:      
 
Domain Number 31 Region: 1483-1530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000661
Family EGF-type module 0.00018
Further Details:      
 
Domain Number 32 Region: 2247-2289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000926
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000009928
Domain Number - Region: 150-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00122
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 116-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0957
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009928   Gene: ENSDORG00000010561   Transcript: ENSDORT00000010564
Sequence length 2867
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_603:153900:358109:-1 gene:ENSDORG00000010561 transcript:ENSDORT00000010564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGALLEIALGFTVLLASYTSHGADTNLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQISPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECSTIPGICD
GGECTNTVSSYFCKCPPGFYTSPDGTRCVDVRPGYCYTALANGRCSNQLPQSITKMQCCC
DVGRCWSPGVTVAPEMCPIRSTEDFNKLCSVPMVFPGRPEYPPPPLGPIPPVQPVPPVFP
PGPVLPVPRPPPEYPYPSPSREPPRVLPFNVTDYCQLVRYLCQNGRCIPTPGSYRCECNK
GFQLDLRGECIDVDECEKNPCTGGECINTQGSYTCHCRAGYQSTLTRTECRDIDECLQNG
RICNHGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCIC
KPGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMR
STCYGGYKRGQCVKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMT
SAGTDINECALDPDICPNGICENLRGTYKCVCNSGYEVDITGKNCVDINECVLNSLLCDN
GQCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESNPCINGVCKNSPGSFICECSPESTL
DPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTICQVDPVCGK
GFSRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPNGMTLDATGRICLDIRLETC
FLRYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKD
ITNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISP
DLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGTCINTEGSYRC
ECPPGHQLSPNISACIDINECELSANLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDI
DECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIP
GEYRCLCFDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDLGYSGKKGKT
GCTDINECEIGAHNCGRHAVCTNTAGSFKCSCSPGWIGDGVKCTDLDECSNGTHMCSQHA
DCKNTMGSYRCLCKEGYTGDGFTCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPTTCI
SGNCVNTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDIRPRGDNGDTACSNEIGVGVS
KASCCCSLGKAWGTPCELCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPGLCQ
GGKCINTFGSFQCRCPTGYYLNEENRVCDDVNECETPGICGPGTCYNTIGNYTCICPPDY
MQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCYNIGRAWNKPCEQCPVP
STDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCDNGVCINMVGSFRCECPVGFFY
NDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCDCKPGYRLTSTGQCNDRNECQEIPNI
CSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCRCNHG
FILSHNNDCIDVDECATGIGNLCRNGQCINVDSFQCQCNEGYDVAPTRRTCVDINECLLE
PGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGSFKCLC
PEGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDPCELCP
TEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPFGYILE
GNECVDTDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDINECAQNPLLCAFR
CVNTYGSYECKCPAGYVLREDRRMCKDEDECEEGKHDCTEKQMECKNLIGTYMCICGPGY
QRRPDGEGCVDENECQTKPGICENGRCINTRGSYTCECNDGFTASPAQDECLDNREGYCF
TEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGRGFMTNG
ADIDECKVIHDVCRNGECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPKPCNFICK
NTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNTIGGFTCKCPPGFTQHHT
ACIDNNECTSDINLCGSKGVCQNTPGSFTCECQRGFSLDQSGASCEDVDECENHRCQHGC
QNIIGGYRCSCPQGYLQHYQNQCENECLSAHICGGASCHNTLGSYKCMCPAGFQYEQFSG
GCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRGGPEPAASSE
MDDNSLSPEACYECKINGYPKRGRKRRSTNETDVSSIQDQSEMEANVSLASWDIEKPATF
AFNISHISNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKRKPVA
GTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences ENSDORP00000009928 ENSDORP00000009928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]