SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009953 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009953
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 3.43e-44
Family Globins 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009953   Gene: ENSDORG00000010590   Transcript: ENSDORT00000010589
Sequence length 190
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5592:98598:108457:-1 gene:ENSDORG00000010590 transcript:ENSDORT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVPGEMEIERRERGEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVIAEEFANDFPPETQGAWTKLRGLIYSHVTAAYKEVGWVQQVPNAAT
PPTTLPSSGP
Download sequence
Identical sequences A0A1S3GVY7
ENSDORP00000009953 ENSDORP00000009953 XP_012893053.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]