SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000009966 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000009966
Domain Number 1 Region: 135-266
Classification Level Classification E-value
Superfamily TIMP-like 5.81e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.025
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 3 Region: 64-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000009966   Gene: ENSDORG00000010603   Transcript: ENSDORT00000010602
Sequence length 282
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_845:84211:92055:-1 gene:ENSDORG00000010603 transcript:ENSDORT00000010602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSCNQHARRCRFNAELFRLSGGRSGGVCERCRHHTAGRHCHYCRPGFWRDPSQSITSRKA
CRACQCHPIGATGGTCNQTSGQCSCKLGVTGLTCNRCGPGYTRQSRSPRMPCQRIPEATT
TLATTPRASSSDPQCQNYCNVSDTRVHMSLQRYCQQEYVVRAQVLAAEEAVVGSAWRRLA
VRVLTVYKQQARPVRPGSQEAWVPRADLACGCLRLRPGTDYLLLGGAAAGGPDPARLVLD
RRGLALPWRPRWARPLRRLQREERAGGCLGLRPPTPNPKSQH
Download sequence
Identical sequences ENSDORP00000009966 ENSDORP00000009966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]