SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010007 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010007
Domain Number 1 Region: 156-308
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.15e-29
Family Ankyrin repeat 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000010007
Domain Number - Region: 71-106
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000311
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010007   Gene: ENSDORG00000010645   Transcript: ENSDORT00000010645
Sequence length 568
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1194:4574:63263:1 gene:ENSDORG00000010645 transcript:ENSDORT00000010645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLQHRKRKHERKRSAGGR
RKKVSFEAGVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGADLLAVNSDGNMPYDLCEDETTL
DVIETCMAYQGITQDKINEMRAAPEQQMISDIHCMIAAGQDLDWIDAQGATLLHIAGANG
YLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMQMAELLVSHGASLSARTSMDEMPID
LCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSTGSRGKVVRRASLSDRTNLYRK
EYEGEAILWQQRSASEDQRTATYNGDIRETRTDQENKDPNPRLEKPVLLSEFSTKISRGE
LDGPVENGLRAPVSAYQYALSNGDVWKMHEVPDYSMAYSNPGVVDATPPWSGYKEQSPQT
LLELKRQRAAAKLLSHPFLSTHLGSSMGRAGESSNEGKAPLIGGRTSPYSSNGTSVYYTV
TSGDPPLLKFKAPMEEMEEKVHGCCRIS
Download sequence
Identical sequences ENSDORP00000010007 ENSDORP00000010007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]