SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010011 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010011
Domain Number 1 Region: 16-128
Classification Level Classification E-value
Superfamily Globin-like 5.68e-32
Family Globins 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010011   Gene: ENSDORG00000010649   Transcript: ENSDORT00000010649
Sequence length 130
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_815:4:582:1 gene:ENSDORG00000010649 transcript:ENSDORT00000010649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRALLLKPGRYIFCVDEALERTFLAFPCTRTYFAHWDLSRGSARIQAHGRKVGAALTLAV
NALDDLPGSLSALSDLHARALRVDPAHFQLLGHCLLVTLARHYPGDFSPAMAALDKFLSL
VTAALVSENR
Download sequence
Identical sequences ENSDORP00000010011 ENSDORP00000010011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]