SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010042 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010042
Domain Number 1 Region: 44-223
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.14e-64
Family Brix domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010042   Gene: ENSDORG00000010685   Transcript: ENSDORT00000010684
Sequence length 253
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_10149:37700:39389:-1 gene:ENSDORG00000010685 transcript:ENSDORT00000010684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKIMITTSRDPSSRLK
MFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGP
TAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFTSRLGKRVSDILRYLFPVPKDDSHRVI
TFANQDDYISFRHHTYKKKDHRNVELTEVGPRFELKLYMIRLGTLEQEAMADVEWRWHPY
TNTARKRVFLSTE
Download sequence
Identical sequences ENSDORP00000010042 ENSDORP00000010042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]