SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010053 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010053
Domain Number 1 Region: 49-77,115-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.24e-30
Family SPRY domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010053   Gene: ENSDORG00000010698   Transcript: ENSDORT00000010697
Sequence length 620
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3408:11778:64980:-1 gene:ENSDORG00000010698 transcript:ENSDORT00000010697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATADPGAGSPQAGDSSSGGAGGGLPSPGDQELSRRLQRLYPAVNQHETPLPRSWSPK
DKYNYIGLSQGNLRVHYKGHGKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMGI
GLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTC
FYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGT
VHGFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQK
LVLEGRVGEAIETTQHFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQD
SYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSS
SSPSSVNYSESNSTDSTKSQPHSSTSNQETSDSEMEMEAEHYPNGMLETMSTRIVNGAYK
HEDLQTDESSMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQ
DAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR
LMARAGLGSCSFARVDDYLH
Download sequence
Identical sequences ENSDORP00000010053 ENSDORP00000010053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]